prothymosin alpha raises a handful of sensible questions. This page answers them in order, starting with the fundamentals and moving to applications.
Reviewed 2025-09-01. Anything still debated is marked as such rather than presented as settled.
Practical handling focuses on limiting adsorption and contamination. The peptide dissolves readily in water, and dilute solutions tend to adhere to plastic and glass surfaces, so an inert carrier protein or a defined buffer can reduce losses in laboratory work. Workers also record the counter-ion form, since an acetate or trifluoroacetate salt changes the mass balance of the weighed powder. Documentation of lot number, purity value, and storage history supports reproducibility when results from different laboratories are compared.
Lyophilized material is generally held at reduced temperature to slow degradation, and storage at minus twenty degrees Celsius or lower is common practice for long-term retention. Short-term working portions are often kept between two and eight degrees Celsius. Once dissolved, the peptide is less stable than the dry powder, and repeated freeze-thaw cycles are associated with loss of material and with aggregate formation. Vials are usually allowed to reach room temperature before opening so that condensation does not introduce moisture, and solutions are protected from light where practical.
Most published studies on thymosin alpha-1 report changes in immune measurements rather than clinical outcomes, and findings differ across designs and populations. Whether the peptide signals through one defined receptor or through several less specific interactions remains an open question. Its reported circulation half-life of a few hours complicates comparison of dosing schedules across trials. Mechanistic claims are frequently drawn from isolated cell cultures, and how far those results extend to whole organisms is unresolved.
Thymosin alpha-1 is a synthetic peptide of 28 amino acids whose sequence matches the amino-terminal region of prothymosin alpha. The chain is acetylated at its first residue and contains one disulfide bridge between two cysteine residues, which folds the molecule into a compact loop. Its molecular formula, C129H215N33O55, corresponds to a monoisotopic mass of roughly 3,106 daltons. Material used in laboratories is made by solid-phase synthesis rather than isolated from animal tissue.
| Property | Value | Notes |
|---|---|---|
| Storage of dry powder | -20 °C or below | Common practice for long-term retention |
| Storage after reconstitution | 2-8 °C, short term | Solution stability is limited compared with dry powder |
| Typical analytical method | Reversed-phase HPLC | Usually paired with mass spectrometry for mass confirmation |
| Detection wavelength | About 214 nm | Peptide backbone absorbance; buffer background must be controlled |
| Counter-ion forms | Acetate or trifluoroacetate | Affects mass balance and reported concentration |
The peptide occurs naturally in thymic tissue and has been detected in serum and other biological fluids. Reported concentrations are low, and reliable measurement generally requires immunoassay or mass spectrometry with an enrichment step. It is released from a larger precursor, prothymosin alpha, by proteolytic cleavage, although the enzymes involved are not fully characterized. Whether circulating levels reflect thymic output specifically remains an open question.
Thymosin alpha 1 is a 28-amino-acid peptide first isolated from thymosin fraction 5, a bovine thymic extract. Its sequence begins with an acetylated serine residue and carries a high proportion of acidic residues, so the molecule has a net negative charge near neutral pH. Despite the shared name, it is unrelated in sequence to the thymosin beta family. Synthetic material prepared by solid-phase peptide synthesis is identical in sequence to the natural peptide.
Several names appear in the literature for this peptide, including thymalfasin and the abbreviation T-alpha-1. Naming conventions differ among research articles, regulatory documents, and supplier catalogs, which complicates literature searches. Both synthetic and recombinant production routes yield a peptide with the same 28-residue sequence as the thymic isolate. Because the thymosin label also covers unrelated peptides, sources should be compared by sequence rather than by name alone.
Clinical interest has centered on chronic viral hepatitis, on immune restoration in various conditions, and on use as an adjuvant intended to improve responses to vaccines. Trials have reported mixed results, and regulatory status differs sharply between countries; in some places it is a prescription product, while elsewhere it is sold without an approved therapeutic indication. Because published studies vary widely in design, population, and endpoints, comparisons across them are difficult and no single conclusion covers the whole literature.
Thymosin alpha 1 is a short peptide of 28 amino acid residues that derives from the amino terminal region of a larger precursor protein known as prothymosin alpha. The peptide carries an acetyl group on its first residue and contains no disulfide bonds or carbohydrate chains. Its sequence is highly conserved across mammalian species, which is one reason laboratories treat it as a molecule with a defined and reproducible structure rather than a variable tissue extract. The name follows an early naming convention for thymus-derived fractions and does not imply that the peptide acts as a hormone in the classical endocrine sense.
Biologically, the peptide is studied mainly in the context of immune cell development and regulation. It is produced in the thymus and in several other tissues, and it appears to influence the maturation and activity of T cells and other immune populations. Laboratory work describes effects on cytokine production, on the balance between T cell subsets, and on the function of dendritic cells. Much of this evidence comes from cell culture and animal models, so the extent to which the same pathways operate in humans remains an open question.
Identity and purity are normally assessed by reversed-phase high-performance liquid chromatography, which separates the peptide from related impurities and truncation products. Mass spectrometry confirms molecular mass and detects modifications such as deamidation or oxidation. Amino acid analysis and peptide mapping provide additional sequence-level confirmation. For research material, a certificate of analysis typically reports these results together with water content and counter-ion identity, since the lyophilized powder is often supplied as an acetate or trifluoroacetate salt.
Several factors accelerate degradation: alkaline pH, elevated temperature, exposure to oxidants, and the presence of residual moisture. Deamidation of asparagine residues and oxidation of methionine are the most commonly reported degradation routes. Because the peptide lacks disulfide bonds, it does not undergo the thiol-related aggregation seen in some other biologics, but physical aggregation can still occur at high concentration. Stability data are product-specific, and extrapolating shelf life between formulations is not reliable.
Lyophilized thymosin alpha-1 is generally stored at or below minus twenty degrees Celsius, protected from moisture and light. Short-term handling at ambient temperature is possible for dry powder, but reconstituted solutions degrade faster and are usually kept at two to eight degrees Celsius with a defined expiry of days rather than weeks. Repeated freeze-thaw cycles should be avoided because they promote aggregation and loss of potency. Exact limits depend on the formulation and should follow the supplier's documentation.
Lyophilized material is typically treated as a hygroscopic solid that should be brought to room temperature before the container is opened, which limits condensation on the powder. Reconstitution is commonly done with sterile water or a buffered diluent, and gentle mixing is preferred over vigorous agitation to reduce foaming and surface adsorption. Because peptides can bind to plastic and glass, diluents containing a small amount of carrier protein are sometimes used in laboratory work. Working solutions are generally aliquoted and prepared fresh rather than subjected to repeated freezing and thawing.
Stability depends on temperature, pH, and the number of freeze-thaw events the sample has experienced. Freeze-dried material is commonly held at -20 °C or colder, while reconstituted liquid is kept cold and used within a short window. Extreme pH and prolonged light exposure can promote deamidation, oxidation, or aggregation, particularly at asparagine and methionine positions. Adsorption to container walls can lower the measured concentration of a dilute solution even when the peptide molecules themselves remain intact.
=== Overbilling the government === In 1992, the company was one of the first to be prosecuted as part of Operation Labscam, a nationwide crackdown on fraud in the healthcare system initiated by the U.S. Attorney's Office in San Diego, California. The company and others were accused of routinely submitting false claims to Medicare and Medicaid for unnecessary tests on blood samples that physicians had never ordered. In addition, charges for the tests billed to the government were significantly higher than what the company charged private insurers. That year, the company agreed to pay $111 million to settle claims. In November 1996, the company agreed to pay a total of $182 million as a result of the investigation. In February 2023, the company paid $19 million to resolve allegations that it violated the False Claims Act of 1863 by its submission of false claims to Medicare.
The fluorenylmethoxycarbonyl protecting group (Fmoc) is a base-labile amine protecting group used in organic synthesis, particularly in peptide synthesis. It is popular for its stability toward acids and hydrolysis and its selective removal by weak bases, such as piperidine, without affecting most other protecting groups or sensitive functional groups. Fmoc protection is especially advantageous in solid-phase peptide synthesis (SPPS), where its compatibility with other reagents and ease of removal streamline synthesis workflows. Upon deprotection, Fmoc yields a byproduct (Dibenzofulvene) that can be monitored by UV spectroscopy, allowing for efficient reaction tracking.
=== Antihistamine === Cidoxepin is under development by Elorac, Inc. for the treatment of chronic urticaria (hives). As of 2017, it is in phase II clinical trials for this indication. The drug was also under investigation for the treatment of allergic rhinitis, atopic dermatitis, and contact dermatitis, but development for these indications was discontinued.
=== Feud with the House and Marcos-Duterte rift === A rift between the Duterte and Marcos families had begun under House Speaker Martin Romualdez' leadership. In the House of Representatives, unconfirmed reports of Deputy House Speaker Gloria-Macapagal Arroyo allegedly attempting to unseat Romualdez as House Speaker circulated. Despite Arroyo dismissing the accusations, Arroyo was later demoted by the House from her senior deputy Speaker position. Duterte's daughter, Vice President and Education Secretary Sara, subsequently resigned from the Romualdez-led Lakas-CMD and, in a veiled reference to Romualdez, called him a "tambaloslos" (A term that can be interpreted as a joke or as an insult, depending on context). In October 2023, Sara requested Congress for the allocation of confidential funds for the office of the vice president (OVP) and the education department which can be used for the Reserve Officers' Training Corps program. Her requests came under intense scrutiny by the Senate and the House, which was dominated by Romualdez's allies. Congress ultimately rejected her appeals while swiftly approving the confidential funds of the Office of the President; Sara eventually dropped her requests, reasoning that the move was being "divisive". In the aftermath of events, Duterte criticized the House for denying his daughter's confidential funds; alleging a collusion between Romualdez and the left-wing Makabayan bloc, he demanded an audit of the House under Romualdez.
=== Ampika's Aesthetics === Pickston is the founder and CEO of Ampika's Aesthetics, a cosmetic training business with schools in Hale, Edinburgh, Bristol, Newcastle and London's Harley Street. It was founded in 2019. The training academy offers aesthetic and cosmetic training for beginners and medical professionals to gain experience and CPD accreditation. It is regulated by OFQUAL through Qualifi.
Sources: en.wikipedia.org
Solutions for total parenteral nutrition may be customized to individual patient requirements, or standardized solutions may be used. The use of standardized parenteral nutrition solutions is cost-effective and may provide better control of serum electrolytes. Ideally each patient is assessed individually before commencing on parenteral nutrition, and a team consisting of specialised doctors, nurses, clinical pharmacists, and registered dietitians evaluate the patient's individual data and decide what PN formula to use and at what infusion rate. For neonates, specialist formulations are required . For energy only, intravenous sugar solutions with glucose (dextrose) are generally used. This is not considered to be parenteral nutrition as it does not prevent malnutrition when used on its own. Standardized solutions may also differ between developers. Following are some examples of what compositions they may have. The solution for normal patients may be given both centrally and peripherally.
On 26 November 2018, the mayor of Moscow, Sergey Sobyanin, participated in the ceremony to launch the cable car above the Moskva River. This car connects the Luzhniki sports complex with Sparrow Hills and Kosygin Street. The trip from the viewpoint on Vorobyovy Gory to Luzhniki Stadium takes only five minutes, rather than 20 minutes by car.
Acupuncture is a substantial part of traditional Chinese medicine (TCM). Early acupuncture beliefs relied on concepts that are common in TCM, such as a life force energy called qi. Qi was believed to flow from the body's primary organs (zang-fu organs) to the "superficial" body tissues of the skin, muscles, tendons, bones, and joints, through channels called meridians. Acupuncture points where needles are inserted are mainly (but not always) found at locations along the meridians. Acupuncture points not found along a meridian are called extraordinary points and those with no designated site are called A-shi points. In TCM, disease is generally perceived as a disharmony or imbalance in energies such as yin, yang, qi, xuĕ, zàng-fǔ, meridians, and of the interaction between the body and the environment. Therapy is based on which "pattern of disharmony" can be identified. For example, some diseases are believed to be caused by meridians being invaded with an excess of wind, cold, and damp. In order to determine which pattern is at hand, practitioners examine things like the color and shape of the tongue, the relative strength of pulse-points, the smell of the breath, the quality of breathing, or the sound of the voice. TCM and its concept of disease does not strongly differentiate between the cause and effect of symptoms. Acupuncture was and is practiced differently by various Chinese philosophical schools, and differs from acupuncture from Korea and Japan.
TATP decomposes explosively; examination of the explosive decomposition of TATP at the very edge of detonation front predicts "formation of acetone and ozone as the main decomposition products and not the intuitively expected oxidation products." Very little heat is created by the explosive decomposition of TATP at the very edge of the detonation front; the foregoing computational analysis suggests that TATP decomposition is an entropic explosion. However, this hypothesis has been challenged as not conforming to actual measurements. The claim of entropic explosion has been tied to the events just behind the detonation front. The authors of the 2004 Dubnikova et al. study confirm that a final redox reaction (combustion) of ozone, oxygen and reactive species into water, various oxides and hydrocarbons takes place within about 180 ps after the initial reaction—within about a micron of the detonation wave. Detonating crystals of TATP ultimately reach temperature of 2,300 K (2,030 °C; 3,680 °F) and pressure of 80 kbar. The final energy of detonation is about 2800 kJ/kg (measured in helium), enough to briefly raise the temperature of gaseous products to 2,000 °C (3,630 °F). Volume of gases at STP is 855 L/kg for TATP and 713 L/kg for DADP (measured in helium). The tetrameric form of acetone peroxide, prepared under neutral conditions using a tin catalyst in the presence of a chelator or general inhibitor of radical chemistry, is reported to be more chemically stable, although still a very dangerous primary explosive. Its synthesis has been disputed.
== Synthesis == ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Sources: en.wikipedia.org
Cool storage below freezing is usual for long-term retention, with a desiccant and protection from light. Portions are often split before first use to avoid repeated handling.
Its sequence corresponds to the amino-terminal portion of prothymosin alpha, a larger protein present in many cell types. The isolated 28-residue peptide is a fragment of that protein rather than a separately encoded molecule, and laboratory material is produced by synthesis.
The single bridge between two cysteine residues holds the chain in a folded loop that influences its shape and its behavior in solution. Loss of the bridge through reduction or oxidation shifts chromatographic retention and is tracked during stability work.
It is a defined 28-residue sequence derived from a larger precursor, whereas many other thymic preparations are mixtures of several polypeptides. Its acetylated amino terminus and single disulfide bridge distinguish it chemically from unrelated thymic extracts.